Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis 60S ribosomal protein L36 (rpl36)

Product Specifications

Abbreviation

Recombinant Xenopus tropicalis rpl36 protein

Gene Name

Rpl36

UniProt

Q6DER2

Expression Region

1-105aa

Organism

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Target Sequence

MAIRYPMAVGLNKGHRVTKNVTKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVLAAMRKAAAKKD

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.8 kDa

References & Citations

NIH - Xenopus Gene Collection (XGC) project Submitted (JUL-2004) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal JMJD1B Antibody [mFluor Violet 610 SE]
NBP1-77071MFV610 0.1 mL

Rabbit Polyclonal JMJD1B Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
MTAP Rabbit Monoclonal Antibody
E56G3068 100 µL

MTAP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Porcine Leukocyte antigen A ELISA Kit
MBS752669-01 48 Well

Porcine Leukocyte antigen A ELISA Kit

Sign In for Pricing
View Details
Porcine Leukocyte antigen A ELISA Kit
MBS752669-02 96 Well

Porcine Leukocyte antigen A ELISA Kit

Sign In for Pricing
View Details
Porcine Leukocyte antigen A ELISA Kit
MBS752669-03 5x 96 Well

Porcine Leukocyte antigen A ELISA Kit

Sign In for Pricing
View Details
Porcine Leukocyte antigen A ELISA Kit
MBS752669-04 10x 96 Well

Porcine Leukocyte antigen A ELISA Kit

Sign In for Pricing
View Details