Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SDF-1 alpha/CXCL12, Mouse (His)

The SDF-1 α/CXCL12 protein acts as a chemoattractant with specific activity on T lymphocytes and monocytes (excluding neutrophils) .It activates the CXC chemokine receptor CXCR4, inducing a rapid and transient rise in intracellular calcium ions and promoting chemotaxis.Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeSDF-1 alpha/CXCL12 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-sdf-1-alpha-cxcl12-protein-mouse-his.html

Purity

98.0

Smiles

MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Formula

20315 (Gene_ID) P40224-1 (G21-K89) (Accession)

Molecular Weight

Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha 67-7)
NB100-130SS 0.025 mL

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha 67-7)

Sign In for Pricing
View Details
Human Heat shock 70 kDa protein 12A,HSPA12A ELISA KIT
ELI-30984h 96 Tests

Human Heat shock 70 kDa protein 12A,HSPA12A ELISA KIT

Sign In for Pricing
View Details
C17orf87 (SCIMP) (NM_207103) Human Mass Spec Standard
PH313295 10 µg

C17orf87 (SCIMP) (NM_207103) Human Mass Spec Standard

Sign In for Pricing
View Details
AOX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV667230 1.0 µg DNA

AOX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PRAMEF10 Antibody (C-term)
orb1938320-01 50 µL

PRAMEF10 Antibody (C-term)

Sign In for Pricing
View Details
PRAMEF10 Antibody (C-term)
orb1938320-02 100 µL

PRAMEF10 Antibody (C-term)

Sign In for Pricing
View Details