Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-2, Human

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

Product Specifications

Product Name Alternative

BD-2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-2-protein-human.html

Purity

98.00

Smiles

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Molecular Formula

1673 (Gene_ID) O15263 (G24-P64) (Accession)

Molecular Weight

Approximately 4.3-9 kDa

References & Citations

[1]Soto E, et al. Human beta-defensin-2: a natural antimicrobial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity. J Matern Fetal Neonatal Med. 2007 Jan;20 (1) :15-22.|[2]Harder J, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000 Jun;22 (6) :714-21.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kirrel2 shRNA (UAS) - Lentiviral mouse Kirrel2 shRNA (UAS) (25)
GTR15203597 1 Vial

Lentiviral mouse Kirrel2 shRNA (UAS) - Lentiviral mouse Kirrel2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Anti OTUB1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA)
IRBAMLOTUB1AP275200UL 1 Each

Rabbit Anti OTUB1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA)

Sign In for Pricing
View Details
TRHR (Thyrotropin-releasing Hormone Receptor, TRH-R, Thyroliberin Receptor) discontinued
T5430-20F 50 µg

TRHR (Thyrotropin-releasing Hormone Receptor, TRH-R, Thyroliberin Receptor) discontinued

Sign In for Pricing
View Details
RFP Rabbit pAb, BF647 conjugated
orb2431814 100 µL

RFP Rabbit pAb, BF647 conjugated

Sign In for Pricing
View Details
EAAT3 discontinued
343050-01 100 µL

EAAT3 discontinued

Sign In for Pricing
View Details
EAAT3 discontinued
343050-02 200 µL

EAAT3 discontinued

Sign In for Pricing
View Details