BD-2, Human
BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.
Product Specifications
Product Name Alternative
BD-2 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bd-2-protein-human.html
Purity
98.00
Smiles
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Molecular Formula
1673 (Gene_ID) O15263 (G24-P64) (Accession)
Molecular Weight
Approximately 4.3-9 kDa
References & Citations
[1]Soto E, et al. Human beta-defensin-2: a natural antimicrobial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity. J Matern Fetal Neonatal Med. 2007 Jan;20 (1) :15-22.|[2]Harder J, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000 Jun;22 (6) :714-21.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2412982 100 µL
Phospho-ATF2 (Ser94) Rabbit Polyclonal Antibody (BF680)
Sign In for Pricing
View Details 
MBS9397986-01 48 Well
Horse Phosphorylated Rho-Associated Protein Kinase 1 (PROCK1) ELISA Kit
Sign In for Pricing
View Details MBS9397986-02 96 Well
Horse Phosphorylated Rho-Associated Protein Kinase 1 (PROCK1) ELISA Kit
Sign In for Pricing
View Details