Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST, Rat (Myc, His)

SOST protein inhibits bone growth by suppressing Wnt signaling and interacting with LRP4 and LRP5. Its interactions with LRP4 and LRP5 play crucial roles in suppressing Wnt signaling. The involvement of SOST in interactions with LRP6 highlights its regulatory role in bone growth. SOST Protein, Rat (Myc, His) is the recombinant rat-derived SOST protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SOST Protein, Rat (Myc, His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sost-protein-rat-myc-his.html

Smiles

FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Molecular Formula

80722 (Gene_ID) Q99P67 (F29-Y213) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYK2 (PTK2B) (NM_173175) Human Recombinant Protein
TP317684L 1 mg

PYK2 (PTK2B) (NM_173175) Human Recombinant Protein

Sign In for Pricing
View Details
bis(2,5-Dioxopiperidin-1-yl) Carbonate
TRC-D215425-50MG 50 mg

bis(2,5-Dioxopiperidin-1-yl) Carbonate

Sign In for Pricing
View Details
Sodium Ethenesulfonate (25% in H2O)
TRC-S699398-50ML 50 mL

Sodium Ethenesulfonate (25% in H2O)

Sign In for Pricing
View Details
rac Pholedrine
TRC-P352000-50MG 50 mg

rac Pholedrine

Sign In for Pricing
View Details
Mouse IgG (H+L), AlpSdAbs® VHH
HA710159 100 µg

Mouse IgG (H+L), AlpSdAbs® VHH

Sign In for Pricing
View Details
BCL2 Rabbit Monoclonal Antibody [Clone ID: R03-9E1]
TA383811 100 µL

BCL2 Rabbit Monoclonal Antibody [Clone ID: R03-9E1]

Sign In for Pricing
View Details