Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST, Rat (Myc, His)

SOST protein inhibits bone growth by suppressing Wnt signaling and interacting with LRP4 and LRP5. Its interactions with LRP4 and LRP5 play crucial roles in suppressing Wnt signaling. The involvement of SOST in interactions with LRP6 highlights its regulatory role in bone growth. SOST Protein, Rat (Myc, His) is the recombinant rat-derived SOST protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SOST Protein, Rat (Myc, His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sost-protein-rat-myc-his.html

Smiles

FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Molecular Formula

80722 (Gene_ID) Q99P67 (F29-Y213) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LST1 (NM_001166538) Human Over-expression Lysate
LY432498 100 µg

LST1 (NM_001166538) Human Over-expression Lysate

Sign In for Pricing
View Details
p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein
TP325202L 1 mg

p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB525202 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
DNAJB6 Mouse Monoclonal Antibody [Clone ID: OTI2F10]
CF810656 100 µg

DNAJB6 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

Sign In for Pricing
View Details
PRTG (NM_173814) Human Recombinant Protein
TP311595M 100 µg

PRTG (NM_173814) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS647653 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details