Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial

Product Specifications

Abbreviation

Recombinant Spinacia oleracea PETE protein, partial

Gene Name

PETE

UniProt

P00289

Expression Region

70-168aa

Organism

Spinacia oleracea (Spinach)

Target Sequence

VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.5 kDa

References & Citations

"Complete genome sequence of the plant commensal Pseudomonas fluorescens Pf-5." Paulsen I.T., Press C.M., Ravel J., Kobayashi D.Y., Myers G.S.A., Mavrodi D.V., DeBoy R.T., Seshadri R., Ren Q., Madupu R., Dodson R.J., Durkin A.S., Brinkac L.M., Daugherty S.C., Sullivan S.A., Rosovitz M.J., Gwinn M.L., Zhou L. Loper J.E. Nat. Biotechnol. 23:873-878 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF594 conjugate, 0.1mg/mL
BNC940778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF740 conjugate, 0.1mg/mL
BNC741224-500 1x 500 µL

HCG-beta (HCGb/54+ HCGb/459), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF488A conjugate, 0.1mg/mL
BNC880261-100 1x 100 µL

CD66 (CEA) (C66/261), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details