Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r56 Protein Vector (Rat) (pPB-N-His)
PV315855 500 ng

Vom2r56 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (MaxLight 750) discontinued
030805-ML750 100 µL

Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant SIV gp 140 Protein (Mac239) (aa 20-692) [His]
VAng-Lsx0505-100g 100 µg

Recombinant SIV gp 140 Protein (Mac239) (aa 20-692) [His]

Sign In for Pricing
View Details
Anti-ANGPTL4 antibody
STJ115386 100 µl

Anti-ANGPTL4 antibody

Sign In for Pricing
View Details
hCG Beta (Free Specific) Antibody
GWB-D43ABE 1 mg

hCG Beta (Free Specific) Antibody

Sign In for Pricing
View Details
GRIP2 Peptide - C-terminal region
MBS3241401-01 0.1 mg

GRIP2 Peptide - C-terminal region

Sign In for Pricing
View Details