Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Leukotriene C4 (LTC4) ELISA Kit
NSL1422m 96 Tests

Mouse Leukotriene C4 (LTC4) ELISA Kit

Sign In for Pricing
View Details
GLO1 Protein (N-His, Mouse)
P524934 100 µg

GLO1 Protein (N-His, Mouse)

Sign In for Pricing
View Details
pCMV-FLAG-ADAM15-mCherry-SV40-Neo Plasmid
PVT51421 2 µg

pCMV-FLAG-ADAM15-mCherry-SV40-Neo Plasmid

Sign In for Pricing
View Details
Emapalumab Biosimilar - Research Grade
ICH5147-20mg 20 mg

Emapalumab Biosimilar - Research Grade

Sign In for Pricing
View Details
TARM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2810307 1.0 µg DNA

TARM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human HCLS1 Protein, His Tag
KMH1203 50 µg

Recombinant Human HCLS1 Protein, His Tag

Sign In for Pricing
View Details