Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse COQ10B shRNA Plasmid
abx976370-01 150 µg

Mouse COQ10B shRNA Plasmid

Sign In for Pricing
View Details
Mouse COQ10B shRNA Plasmid
abx976370-02 300 µg

Mouse COQ10B shRNA Plasmid

Sign In for Pricing
View Details
IRAK2 Antibody
MBS9405934-01 0.1 mL

IRAK2 Antibody

Sign In for Pricing
View Details
IRAK2 Antibody
MBS9405934-02 5x 0.1 mL

IRAK2 Antibody

Sign In for Pricing
View Details
JAG2 (Jagged 2, HJ2, SER2) (MaxLight 550)
MBS6217684-01 0.1 mL

JAG2 (Jagged 2, HJ2, SER2) (MaxLight 550)

Sign In for Pricing
View Details
JAG2 (Jagged 2, HJ2, SER2) (MaxLight 550)
MBS6217684-02 5x 0.1 mL

JAG2 (Jagged 2, HJ2, SER2) (MaxLight 550)

Sign In for Pricing
View Details