Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anks1b (NM_181398) Mouse Tagged Lenti ORF Clone
MR219884L3 10 µg

Anks1b (NM_181398) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PHF20L1 activation kit by CRISPRa
GA109569 1 Kit

Human PHF20L1 activation kit by CRISPRa

Sign In for Pricing
View Details
PET117 (NM_001164811) Human Tagged Lenti ORF Clone
RC228028L4 10 µg

PET117 (NM_001164811) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GCG Antibody
A13997-100UG 100 µg

GCG Antibody

Sign In for Pricing
View Details
Chicken Embigin (EMB) ELISA Kit
MBS9376201 Inquire

Chicken Embigin (EMB) ELISA Kit

Sign In for Pricing
View Details
Brilliant Violet 605™ anti-human CD326 (Ep-CAM)
GT10191 25 Tests

Brilliant Violet 605™ anti-human CD326 (Ep-CAM)

Sign In for Pricing
View Details