Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tra2a Mouse shRNA Plasmid (Locus ID 101214)
TL505613 1 Kit

Tra2a Mouse shRNA Plasmid (Locus ID 101214)

Sign In for Pricing
View Details
Seniprutug Biosimilar - Research Grade
ICH5852-5mg 5 mg

Seniprutug Biosimilar - Research Grade

Sign In for Pricing
View Details
C3orf49 Polyclonal Antibody, Cy5 Conjugated
bs-9831R-Cy5 100 µL

C3orf49 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
LOC689713 (NM_001047978) Rat Tagged ORF Clone Lentiviral Particle
RR208506L3V 200 µL

LOC689713 (NM_001047978) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPE65 Protein, Human, Recombinant (His & Myc)
MF-0104091-01 5 µg

RPE65 Protein, Human, Recombinant (His & Myc)

Sign In for Pricing
View Details
RPE65 Protein, Human, Recombinant (His & Myc)
MF-0104091-02 10 µg

RPE65 Protein, Human, Recombinant (His & Myc)

Sign In for Pricing
View Details