Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD300LD (NM_001115152) Human Over-expression Lysate
LC426525 20 µg

CD300LD (NM_001115152) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR116 Protein Vector (Human) (pPB-C-His)
PV081369 500 ng

GPR116 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
THNSL2 (NM_018271) Human Over-expression Lysate
LC413167 20 µg

THNSL2 (NM_018271) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal MAP3K15 Antibody (OTI1G10) [Alexa Fluor 594]
NBP2-72588AF594 0.1 mL

Mouse Monoclonal MAP3K15 Antibody (OTI1G10) [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. Glutamine amidotransferase subunit pdxT (pdxT)
MBS1442734-01 0.02 mg (E-Coli)

Recombinant Mycobacterium sp. Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. Glutamine amidotransferase subunit pdxT (pdxT)
MBS1442734-02 0.1 mg (E-Coli)

Recombinant Mycobacterium sp. Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details