CD5, Rhesus Macaque (HEK293, His)
CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html
Purity
99.00
Smiles
RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP
Molecular Formula
/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)
Molecular Weight
Approximately 41.81 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal CXCL1/GRO alpha/KC/CINC-1 Antibody (20326) [Janelia Fluor 635]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FAB275JF635 0.1 mL
Mouse Monoclonal CXCL1/GRO alpha/KC/CINC-1 Antibody (20326) [Janelia Fluor 635]
Sign In for Pricing
View Details WS0542B 100 µg
Bovine WC1 (+) gamma delta T cell (WC1-N22 epitope) Monoclonal Antibody (clone CACTB31A)
Sign In for Pricing
View Details 
K0310006 1.0 µg DNA
C16orf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details L1R-M5241-500ug 500 µg
Monkeypox virus (strain Zaire-96-I-16) L1R Protein, His Tag (HPLC verified)
Sign In for Pricing
View Details 