Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A28 (NM_031212) Human Tagged Lenti ORF Clone
RC208960L4 10 µg

SLC25A28 (NM_031212) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-DCUN1D1 Antibody, Rabbit Polyclonal
MBS8124550-01 0.1 mL

Anti-DCUN1D1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-DCUN1D1 Antibody, Rabbit Polyclonal
MBS8124550-02 5x 0.1 mL

Anti-DCUN1D1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Mouse Secretoglobin family 3A member 2, Scgb3a2 ELISA KIT
ELI-53250m 96 Tests

Mouse Secretoglobin family 3A member 2, Scgb3a2 ELISA KIT

Sign In for Pricing
View Details
Phospho-EIF4EBP1-T37/46 Rabbit pAb
MBS8550562-01 0.1 mL

Phospho-EIF4EBP1-T37/46 Rabbit pAb

Sign In for Pricing
View Details
Phospho-EIF4EBP1-T37/46 Rabbit pAb
MBS8550562-02 0.1 mL (AF405L)

Phospho-EIF4EBP1-T37/46 Rabbit pAb

Sign In for Pricing
View Details