Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA2 (Proteasome Alpha 2, MU, HC3, PSC2) (Biotin)
MBS6433494-01 0.1 mL

PSMA2 (Proteasome Alpha 2, MU, HC3, PSC2) (Biotin)

Sign In for Pricing
View Details
PSMA2 (Proteasome Alpha 2, MU, HC3, PSC2) (Biotin)
MBS6433494-02 5x 0.1 mL

PSMA2 (Proteasome Alpha 2, MU, HC3, PSC2) (Biotin)

Sign In for Pricing
View Details
LRRN1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV686273 1.0 µg DNA

LRRN1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
B3GNT4 Human qPCR Template Standard (NM_030765)
HK201021 1 Kit

B3GNT4 Human qPCR Template Standard (NM_030765)

Sign In for Pricing
View Details
TUFM Protein Vector (Rat) (pPM-C-HA)
PV313764 500 ng

TUFM Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Vasohibin 1 (VASH1) ELISA Kit
MBS9369280 Inquire

Rabbit Vasohibin 1 (VASH1) ELISA Kit

Sign In for Pricing
View Details