Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ME2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1284207 1.0 µg DNA

ME2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal AASS Antibody
NBP1-82831-25ul 25 µL

Rabbit Polyclonal AASS Antibody

Sign In for Pricing
View Details
Lrrc23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6570805 3x 1.0 µg

Lrrc23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-II region TRO
MBS1018025-01 0.02 mg (E-Coli)

Recombinant Human Ig lambda chain V-II region TRO

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-II region TRO
MBS1018025-02 0.1 mg (E-Coli)

Recombinant Human Ig lambda chain V-II region TRO

Sign In for Pricing
View Details
Recombinant Human Ig lambda chain V-II region TRO
MBS1018025-03 0.02 mg (Yeast)

Recombinant Human Ig lambda chain V-II region TRO

Sign In for Pricing
View Details