Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 3'UTR Luciferase Stable Cell Line
TU007940 1.0 mL

FGFR1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Dioctyl Azelate
TRC-D400120-1G 1 g

Dioctyl Azelate

Sign In for Pricing
View Details
RPL6P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV774984 1.0 µg DNA

RPL6P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ASGR2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0134102 1.0 µg DNA

ASGR2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Creatine Kinase B (CK-BB)
MBS2145250-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Creatine Kinase B (CK-BB)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Creatine Kinase B (CK-BB)
MBS2145250-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Creatine Kinase B (CK-BB)

Sign In for Pricing
View Details