Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RH 1788
TRC-R315765-250MG 250 mg

RH 1788

Sign In for Pricing
View Details
UBBP3 sgRNA CRISPR Lentivector (Human) (Target 1)
K2569802 1.0 µg DNA

UBBP3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Tenascin-R (TNR) Mouse ELISA Kit
H5077 96 Tests

Tenascin-R (TNR) Mouse ELISA Kit

Sign In for Pricing
View Details
Atp5s 3'UTR Luciferase Stable Cell Line
TU201092 1.0 mL

Atp5s 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Monoclonal CD46 Antibody (FOR46) [Janelia Fluor 669]
NBP3-28644JF669 0.1 mL

Human Monoclonal CD46 Antibody (FOR46) [Janelia Fluor 669]

Sign In for Pricing
View Details
Mouse Ras Homolog Gene Family, Member A (RHOA)(Sandwich ELISA) ELISA Kit
MBS2709703-01 24 Strip Well

Mouse Ras Homolog Gene Family, Member A (RHOA)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details