Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STC1 Antibody, Biotin conjugated
MBS1498147-01 0.05 mg

STC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
STC1 Antibody, Biotin conjugated
MBS1498147-02 0.1 mg

STC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
STC1 Antibody, Biotin conjugated
MBS1498147-03 5x 0.1 mg

STC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LOC687090 Protein Vector (Rat) (pPM-C-His)
PV279321 500 ng

LOC687090 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human NTPDase 2/ENTPD2 Protein (aa 29-460, His Tag)
PKSH031019 50 µg

Recombinant Human NTPDase 2/ENTPD2 Protein (aa 29-460, His Tag)

Sign In for Pricing
View Details
Recombinant Human SIGMAR1
MBS7613088-01 0.05 mg

Recombinant Human SIGMAR1

Sign In for Pricing
View Details