Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Stem Cell Factor Recombinant (mammalian)
MBS554061-01 0.01 mg

Human Stem Cell Factor Recombinant (mammalian)

Sign In for Pricing
View Details
Human Stem Cell Factor Recombinant (mammalian)
MBS554061-02 0.05 mg

Human Stem Cell Factor Recombinant (mammalian)

Sign In for Pricing
View Details
Human Stem Cell Factor Recombinant (mammalian)
MBS554061-03 1 mg

Human Stem Cell Factor Recombinant (mammalian)

Sign In for Pricing
View Details
Human Stem Cell Factor Recombinant (mammalian)
MBS554061-04 5x 1 mg

Human Stem Cell Factor Recombinant (mammalian)

Sign In for Pricing
View Details
DIPK2B (NM_176819) Human Tagged ORF Clone
RG225710 10 µg

DIPK2B (NM_176819) Human Tagged ORF Clone

Sign In for Pricing
View Details
Exo1 siRNA (h)
sc-44880 10 µM

Exo1 siRNA (h)

Sign In for Pricing
View Details