Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human adeno-associated virus, AAV ELISA Kit
NSL2735Hu 96 Tests

Human adeno-associated virus, AAV ELISA Kit

Sign In for Pricing
View Details
[KO Validated] MAPK12 Rabbit pAb
A21595 200 µL

[KO Validated] MAPK12 Rabbit pAb

Sign In for Pricing
View Details
MEX3C, CT (MEX3C, RKHD2, RNF194, RNA-binding protein MEX3C, RING finger and KH domain-containing protein 2, RING finger protein 194) (PE) discontinued
038393-PE 200 µL

MEX3C, CT (MEX3C, RKHD2, RNF194, RNA-binding protein MEX3C, RING finger and KH domain-containing protein 2, RING finger protein 194) (PE) discontinued

Sign In for Pricing
View Details
EIF4EBP1 Rabbit Monoclonal Antibody (Capture)
E56PA0362 100 µL

EIF4EBP1 Rabbit Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
PLCB1 Antibody
E30AC3860 100 µL

PLCB1 Antibody

Sign In for Pricing
View Details
Zfp382 (NM_001081007) Mouse Tagged ORF Clone
MG216418 10 µg

Zfp382 (NM_001081007) Mouse Tagged ORF Clone

Sign In for Pricing
View Details