CD5, Rhesus Macaque (HEK293, His)
CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html
Purity
99.00
Smiles
RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP
Molecular Formula
/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)
Molecular Weight
Approximately 41.81 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
G9039-53A-ML490 100 µL
RASGRF1 (S929) (Ras-specific Guanine Nucleotide-releasing Factor 1, Ras-GRF1, Guanine Nucleotide-releasing Protein, Ras-specific Nucleotide Exchange Factor CDC25, CDC25, GNRP, GRF1) (MaxLight 490) discontinued
Sign In for Pricing
View Details VAng-Cr3018-1mgEcoli 1 mg (E. coli)
Recombinant Vibrio Cholerae csrA Protein (aa 1-65) (strain M66-2)
Sign In for Pricing
View Details 
GTR15267661 1 Vial
Lentiviral mouse Tram1 shRNA (UAS) - Lentiviral mouse Tram1 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details