Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KA2/GRIK5/Glutamate Receptor KA2 Antibody [DyLight 680]
NBP1-76853FR 0.1 mL

Rabbit Polyclonal KA2/GRIK5/Glutamate Receptor KA2 Antibody [DyLight 680]

Sign In for Pricing
View Details
SAMD9L Double Nickase Plasmid (m)
sc-431615-NIC 20 µg

SAMD9L Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4064) [Alexa Fluor 405]
NBP3-08606AF405 100 µL

Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4064) [Alexa Fluor 405]

Sign In for Pricing
View Details
ZACN CRISPRa sgRNA lentivector (set of three targets)(Human)
50668121 3x 1.0µg DNA

ZACN CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Cdc27 Antibody
NBP1-89095 0.1 mL

Rabbit Polyclonal Cdc27 Antibody

Sign In for Pricing
View Details
TCF7L2 (NM_001146283) Human Over-expression Lysate
LY431432 100 µg

TCF7L2 (NM_001146283) Human Over-expression Lysate

Sign In for Pricing
View Details