CD5, Rhesus Macaque (HEK293, His)
CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html
Purity
99.00
Smiles
RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP
Molecular Formula
/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)
Molecular Weight
Approximately 41.81 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
L1024-15B 100 µg
LPO (Salivary Peroxidase, SPO, Lactoperoxidase, SAPX)
Sign In for Pricing
View Details MBS723580-01 48 Well
Rat Low-density lipoprotein receptor-related protein 1 ELISA Kit
Sign In for Pricing
View Details 
MBS723580-02 96 Well
Rat Low-density lipoprotein receptor-related protein 1 ELISA Kit
Sign In for Pricing
View Details MBS723580-03 5x 96 Well
Rat Low-density lipoprotein receptor-related protein 1 ELISA Kit
Sign In for Pricing
View Details 
MBS723580-04 10x 96 Well
Rat Low-density lipoprotein receptor-related protein 1 ELISA Kit
Sign In for Pricing
View Details