Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Rhesus Macaque (HEK293, His)

CD5 Protein lacks conserved residue (s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-rhesus-macaque-hek293-his.html

Purity

99.00

Smiles

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Formula

/ (Gene_ID) F6V5Q9 (R25-P375) (Accession)

Molecular Weight

Approximately 41.81 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MED24 Antibody
NBP3-04464-20ul 20 µL

Rabbit Polyclonal MED24 Antibody

Sign In for Pricing
View Details
JSRP1 (NM_144616) Human 3' UTR Clone
SC200324 10 µg

JSRP1 (NM_144616) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant IAV H5N1 Hemagglutinin / HA Protein (aa 1-530) [His] (A/Hubei/1/2010) (HEK293 Cells)
VAng-Wyb7193-100g 100 µg

Recombinant IAV H5N1 Hemagglutinin / HA Protein (aa 1-530) [His] (A/Hubei/1/2010) (HEK293 Cells)

Sign In for Pricing
View Details
ZKSCAN1 Antibody
MBS9416988-01 0.1 mL

ZKSCAN1 Antibody

Sign In for Pricing
View Details
ZKSCAN1 Antibody
MBS9416988-02 5x 0.1 mL

ZKSCAN1 Antibody

Sign In for Pricing
View Details
Human Herpes virus type 6 IgM antibody (HHV6-Ab-IgM) ELISA Kit
AE64501HU-01 48 Tests

Human Herpes virus type 6 IgM antibody (HHV6-Ab-IgM) ELISA Kit

Sign In for Pricing
View Details