CDC42, Human (GST)
Product Specifications
UNSPSC Description
CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (GST) is the recombinant human-derived CDC42 protein, expressed by E. coli , with N-GST labeled tag. The total length of CDC42 Protein, Human (GST) is 188 a.a., with molecular weight of ~44 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cdc42-protein-human-gst.html
Purity
97.00
Smiles
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular Weight
Approximately 44 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog