Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic anhydrase 6 (CA6)

Product Specifications

Product Name Alternative

(Carbonate dehydratase VI) (Carbonic anhydrase VI) (CA-VI) (Salivary carbonic anhydrase) (Secreted carbonic anhydrase)

Abbreviation

Recombinant Human CA6 protein

Gene Name

CA6

UniProt

P23280

Expression Region

18-308aa

Organism

Homo sapiens (Human)

Target Sequence

QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Reversible hydration of carbon dioxide. Its role in saliva is unknown.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.0 kDa

References & Citations

"Saccharin inhibits carbonic anhydrases: possible explanation for its unpleasant metallic aftertaste." Koehler K., Hillebrecht A., Schulze Wischeler J., Innocenti A., Heine A., Supuran C.T., Klebe G. Angew. Chem. Int. Ed. Engl. 46:7697-7699 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epalrestat Impurity 23
RM-E161248-01 10 mg

Epalrestat Impurity 23

Sign In for Pricing
View Details
Epalrestat Impurity 23
RM-E161248-02 25 mg

Epalrestat Impurity 23

Sign In for Pricing
View Details
Epalrestat Impurity 23
RM-E161248-03 50 mg

Epalrestat Impurity 23

Sign In for Pricing
View Details
Epalrestat Impurity 23
RM-E161248-04 100 mg

Epalrestat Impurity 23

Sign In for Pricing
View Details
Lysosomal Intracellular Activity Assay Kit
EGN0106 50 Tests

Lysosomal Intracellular Activity Assay Kit

Sign In for Pricing
View Details
Propoxycarbazone (sodium) (Standard)
HY-W714171R 1 Each

Propoxycarbazone (sodium) (Standard)

Sign In for Pricing
View Details