Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coxiella burnetii Uncharacterized protein (CBU_0425), partial

Product Specifications

Abbreviation

Recombinant Coxiella burnetii CBU_0425 protein, partial

Gene Name

CBU_0425

UniProt

Q83EA1

Expression Region

153-320aa

Organism

Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

Target Sequence

TSETDTVPNELQQVLQSLKSDSLILSTPSTIQSWFKNPPQKTDLKTVYDTTITLDLSQAKNLIIAPPQPEEKQIEKTPKEKMQTLAENLTKEVTTKKLSINGIPTVINEWESEQNLKKEIPSLWGEFVQDIKVLKNKEPEIVIQTIKGWIEGLYYNDSTSSDKEAAIR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.1 kDa

References & Citations

"Comparative genomics reveal extensive transposon-mediated genomic plasticity and diversity among potential effector proteins within the genus Coxiella." Beare P.A., Unsworth N., Andoh M., Voth D.E., Omsland A., Gilk S.D., Williams K.P., Sobral B.W., Kupko J.J.III., Porcella S.F., Samuel J.E., Heinzen R.A. Infect. Immun. 77:642-656 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST8SIA1 (NM_003034) Human Over-expression Lysate
LC401062 20 µg

ST8SIA1 (NM_003034) Human Over-expression Lysate

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), CF568 conjugate, 0.1mg/mL
BNC681961-500 1x 500 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRSS16 (NM_005865) Human Recombinant Protein
TP323128 20 µg

PRSS16 (NM_005865) Human Recombinant Protein

Sign In for Pricing
View Details
C22orf36 (LRRC75B) (NM_207644) Human Over-expression Lysate
LC403931 20 µg

C22orf36 (LRRC75B) (NM_207644) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Grp75 (HSPA9) activation kit by CRISPRa
GA102264 1 Kit

Human Grp75 (HSPA9) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant AKR1B1 Monoclonal Antibody
AN300120P 100 µL

Recombinant AKR1B1 Monoclonal Antibody

Sign In for Pricing
View Details