Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Activin RIB/ALK-4, Human (HEK293, His)

Activin RIB, also known as activin receptor type-1B (ACVR1B) or ALK-4, is a type I transmembrane serine/threonine kinase receptor that is part of the TGF-β receptor superfamily. Activin binds to a type II activin receptor (ACVR2or ACVR2B) and then recruits ACVR1B[1][2][3]. Activin RIB/ALK-4 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 103 amino acids (S24-E126) .

Product Specifications

Product Name Alternative

Activin RIB/ALK-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/activin-receptor-ib-protein-human-hek293-his.html

Purity

95.0

Smiles

SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVEHHHHHH

Molecular Formula

91 (Gene_ID) P36896 (S24-E126) (Accession)

Molecular Weight

14-20 kDa

References & Citations

[1]Dev Dyn, et al. Developmental analysis of activin-like kinase receptor-4 (ALK4) expression in Xenopus laevis. . 2005 Feb;232 (2) :393-8.|[2]Qian Wang, et al. Activin Receptor-Like Kinase 4 Haplodeficiency Mitigates Arrhythmogenic Atrial Remodeling and Vulnerability to Atrial Fibrillation in Cardiac Pathological Hypertrophy. J Am Heart Assoc. 2018 Aug 21;7 (16) :e008842.|[3]Wanglong Qiu, et al. Conditional activin receptor type 1B (Acvr1b) knockout mice reveal hair loss abnormality. J Invest Dermatol. 2011 May;131 (5) :1067-76.|[4]G H Su, et al. ACVR1B (ALK4, activin receptor type 1B) gene mutations in pancreatic carcinoma. Proc Natl Acad Sci U S A. 2001 Mar 13;98 (6) :3254-7.|[5]Kamil Matulka, et al. PTP1B is an effector of activin signaling and regulates neural specification of embryonic stem cells. Cell Stem Cell. 2013 Dec 5;13 (6) :706-19.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laemmli Sample Buffer (4x)
LSB-4x 10 ml

Laemmli Sample Buffer (4x)

Sign In for Pricing
View Details
APOA4 Protein Lysate (Human) with C-Ha Tag
12159032 100 µg

APOA4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 51B5 (OR51B5)
MBS7024931-01 0.02 mg

Recombinant Human Olfactory receptor 51B5 (OR51B5)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 51B5 (OR51B5)
MBS7024931-02 0.1 mg

Recombinant Human Olfactory receptor 51B5 (OR51B5)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 51B5 (OR51B5)
MBS7024931-03 5x 0.1 mg

Recombinant Human Olfactory receptor 51B5 (OR51B5)

Sign In for Pricing
View Details
Bovine vacuolar protein sorting 72 homolog (S. cerevisiae) ELISA Kit
OM623472 96 Strip Well

Bovine vacuolar protein sorting 72 homolog (S. cerevisiae) ELISA Kit

Sign In for Pricing
View Details