Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus CD27 antigen (Cd27), partial

Product Specifications

Abbreviation

Recombinant Mesocricetus auratus Cd27 protein, partial

Gene Name

Cd27

UniProt

A0A3Q0DDP5

Expression Region

21-187aa

Organism

Mesocricetus auratus (Golden hamster)

Target Sequence

TPASKSCPVRHYWTRGGLCCQLCKPGTFFVSDCSQNRTAALCEPCTPGVSFSPDFHTRPHCESCRHCNSGLLIRNCTIAANAECACSKGWQCRDQECTECDPPLNPALTTQPSVAPGPHPQPTHLPYAQEMAEARTVWPVHTRQFPASTLYNHWPSQRPLCSSDCVR

Tag

N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.5 kDa

References & Citations

1 RefSeq Submitted (APR-2022) to UniProtKB Cited for: IDENTIFICATION.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOPORS-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47313061 1.0 µg DNA

TOPORS-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RECQ1 (RECQL) (NM_032941) Human Over-expression Lysate
LH12994V 100 µg

RECQ1 (RECQL) (NM_032941) Human Over-expression Lysate

Sign In for Pricing
View Details
GENLISA™ Human KeRatin, type I cytoskeletal 17 (KRT17) ELISA
KBH3568 96 Well

GENLISA™ Human KeRatin, type I cytoskeletal 17 (KRT17) ELISA

Sign In for Pricing
View Details
Human ASGR2 AssayLite™ Antibody (FITC Conjugate)
33449-05141 2x 75 µg

Human ASGR2 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Complement Factor P (CFP, BFD, Factor P, PFC, PFD, Properdin, Properdin P Factor Complement) (FITC)
MBS6249787-01 0.1 mL

Complement Factor P (CFP, BFD, Factor P, PFC, PFD, Properdin, Properdin P Factor Complement) (FITC)

Sign In for Pricing
View Details
Complement Factor P (CFP, BFD, Factor P, PFC, PFD, Properdin, Properdin P Factor Complement) (FITC)
MBS6249787-02 5x 0.1 mL

Complement Factor P (CFP, BFD, Factor P, PFC, PFD, Properdin, Properdin P Factor Complement) (FITC)

Sign In for Pricing
View Details