Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Uncharacterized protein

Product Specifications

Abbreviation

Recombinant Azotobacter vinelandii Uncharacterized protein

UniProt

C1DPA0

Expression Region

1-133aa

Organism

Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

Target Sequence

MSVREAGQKGGEIRKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGKKGGEARKEQLGPEGYSELGHKGGQRVRELIEEGKRAEGQQGSQGGKQENRGQSRQEDQDKGSRKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CISH (NM_145071) Human Over-expression Lysate
LY403423 100 µg

CISH (NM_145071) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Hemoglobin Gamma 2 (HBg2) ELISA Kit
RD-HBg2-Hu-01 96 Tests

Human Hemoglobin Gamma 2 (HBg2) ELISA Kit

Sign In for Pricing
View Details
Human Hemoglobin Gamma 2 (HBg2) ELISA Kit
RD-HBg2-Hu-02 48 Tests

Human Hemoglobin Gamma 2 (HBg2) ELISA Kit

Sign In for Pricing
View Details
Recombinant STUB1 Monoclonal Antibody
AN300115P 100 µL

Recombinant STUB1 Monoclonal Antibody

Sign In for Pricing
View Details
Human PKD1L1 activation kit by CRISPRa
GA116174 1 Kit

Human PKD1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
t-Butyl (3R,5S)-7-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]-3,5-isopropylidenedioxy-6-heptenoate
TRC-B689830-250MG 250 mg

t-Butyl (3R,5S)-7-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]-3,5-isopropylidenedioxy-6-heptenoate

Sign In for Pricing
View Details