Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Mouse

HB-EGF Protein, Mouse is shown to play a role in wound healing, cardiac hypertrophy, and heart development and function.

Product Specifications

Product Name Alternative

HB-EGF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-mouse.html

Purity

97.00

Smiles

DLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTL

Molecular Formula

15200 (Gene_ID) Q06186 (D63-L148) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Ongusaha PP, et al. HB-EGF is a potent inducer of tumor growth and angiogenesis. Cancer Res. 2004 Aug 1;64 (15) :5283-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ME2, His-tag
P7014-100μg 100 µg

Recombinant Human ME2, His-tag

Sign In for Pricing
View Details
ACSL6 Antibody
orb127624-01 25 µg

ACSL6 Antibody

Sign In for Pricing
View Details
ACSL6 Antibody
orb127624-02 50 µg

ACSL6 Antibody

Sign In for Pricing
View Details
ACSL6 Antibody
orb127624-03 100 µg

ACSL6 Antibody

Sign In for Pricing
View Details
ACSL6 Antibody
orb127624-04 200 µg

ACSL6 Antibody

Sign In for Pricing
View Details
Gdi2 3'UTR Luciferase Stable Cell Line
TU205031 1.0 mL

Gdi2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details