Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Mouse

HB-EGF Protein, Mouse is shown to play a role in wound healing, cardiac hypertrophy, and heart development and function.

Product Specifications

Product Name Alternative

HB-EGF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-mouse.html

Purity

97.00

Smiles

DLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTL

Molecular Formula

15200 (Gene_ID) Q06186 (D63-L148) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Ongusaha PP, et al. HB-EGF is a potent inducer of tumor growth and angiogenesis. Cancer Res. 2004 Aug 1;64 (15) :5283-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody
MBS9438649-01 0.1 mL (Biotin)

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody

Sign In for Pricing
View Details
AKT1/2 (Phospho-Thr308/309) Conjugated Antibody
MBS9438649-02 0.1 mL (AF350)

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody

Sign In for Pricing
View Details
AKT1/2 (Phospho-Thr308/309) Conjugated Antibody
MBS9438649-03 0.1 mL (AF405)

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody

Sign In for Pricing
View Details
AKT1/2 (Phospho-Thr308/309) Conjugated Antibody
MBS9438649-04 0.1 mL (AF488)

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody

Sign In for Pricing
View Details
AKT1/2 (Phospho-Thr308/309) Conjugated Antibody
MBS9438649-05 0.1 mL (AF555)

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody

Sign In for Pricing
View Details
AKT1/2 (Phospho-Thr308/309) Conjugated Antibody
MBS9438649-06 0.1 mL (AF594)

AKT1/2 (Phospho-Thr308/309) Conjugated Antibody

Sign In for Pricing
View Details