Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-5, Human

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GDF-5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-5-protein-human.html

Purity

98.00

Smiles

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Formula

8200 (Gene_ID) P43026 (A382-R501) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msantd4 siRNA (m)
sc-140492 10 µM

Msantd4 siRNA (m)

Sign In for Pricing
View Details
4930519G04Rik AAV siRNA Pooled Vector
10653164 1.0 µg

4930519G04Rik AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FEN1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-9876R-APC-Cy5.5 100 µL

FEN1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
ISOC2 Antibody
E305544 100 µg - 200 µL

ISOC2 Antibody

Sign In for Pricing
View Details
RGS6 ORF Vector (Human) (pORF)
39484011 1.0 µg DNA

RGS6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Rat SERPING1 Protein, His (Fc)-Avi-tagged
SERPING1-5004R 50 µg

Recombinant Rat SERPING1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details