Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-5, Human

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GDF-5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-5-protein-human.html

Purity

98.00

Smiles

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Formula

8200 (Gene_ID) P43026 (A382-R501) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Anti-TNFSF15 Antibody
TA351829 100 µL

Rabbit Polyclonal Anti-TNFSF15 Antibody

Sign In for Pricing
View Details
Xen-dorphin-1A - I-125 Labeled
T-022-52 10 µCi

Xen-dorphin-1A - I-125 Labeled

Sign In for Pricing
View Details
Recombinant Human CKB Protein, Untagged, Pichia Pastoris-10ug
QP10552-10ug 10ug

Recombinant Human CKB Protein, Untagged, Pichia Pastoris-10ug

Sign In for Pricing
View Details
Rat RPS9 shRNA Plasmid
abx986705-01 150 µg

Rat RPS9 shRNA Plasmid

Sign In for Pricing
View Details
Rat RPS9 shRNA Plasmid
abx986705-02 300 µg

Rat RPS9 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (FOXA1/1512) [HRP]
NBP2-54576H 100 µL

Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (FOXA1/1512) [HRP]

Sign In for Pricing
View Details