Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-5, Human

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GDF-5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-5-protein-human.html

Purity

98.00

Smiles

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Formula

8200 (Gene_ID) P43026 (A382-R501) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse Ly6C Flow Cytometry Monoclonal Clone MONTS1 APC 100ug
IRTAMSLY6CMONTS1CAPC100UG 100 µg

Anti Mouse Ly6C Flow Cytometry Monoclonal Clone MONTS1 APC 100ug

Sign In for Pricing
View Details
RIM2 (RIMS2) (NM_014677) Human 3' UTR Clone
SC214409 10 µg

RIM2 (RIMS2) (NM_014677) Human 3' UTR Clone

Sign In for Pricing
View Details
SCARA3 Antibody (HRP)
orb31228-01 50 µg

SCARA3 Antibody (HRP)

Sign In for Pricing
View Details
SCARA3 Antibody (HRP)
orb31228-02 100 µg

SCARA3 Antibody (HRP)

Sign In for Pricing
View Details
ACO1 Antibody
orb1174178-01 50 μL

ACO1 Antibody

Sign In for Pricing
View Details
ACO1 Antibody
orb1174178-02 100 µL

ACO1 Antibody

Sign In for Pricing
View Details