GDF-5, Human
The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
GDF-5 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-5-protein-human.html
Purity
98.00
Smiles
APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Molecular Formula
8200 (Gene_ID) P43026 (A382-R501) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral human RPL3L sgRNA gene knockout kit - Lentiviral human RPL3L sgRNA gene knockout kit (100)
FBXW4, CT (F-box/WD Repeat-containing Protein 4, F-box and WD-40 Domain-containing Protein 4, Dactylin, FBW4, SHFM3) (MaxLight 750)
FBXW4, CT (F-box/WD Repeat-containing Protein 4, F-box and WD-40 Domain-containing Protein 4, Dactylin, FBW4, SHFM3) (MaxLight 750)
Recombinant Lepidium virginicum Photosystem I iron-sulfur center (psaC)