Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-5, Human

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GDF-5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-5-protein-human.html

Purity

98.00

Smiles

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Formula

8200 (Gene_ID) P43026 (A382-R501) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Inhibin Beta C (INHbC) ELISA Kit
DLR-INHbC-Hu-01 48 Tests

Human Inhibin Beta C (INHbC) ELISA Kit

Sign In for Pricing
View Details
Human Inhibin Beta C (INHbC) ELISA Kit
DLR-INHbC-Hu-02 96 Tests

Human Inhibin Beta C (INHbC) ELISA Kit

Sign In for Pricing
View Details
MRGPRF 3'UTR Luciferase Stable Cell Line
TU014515 1.0 mL

MRGPRF 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DiagPoly™ Plain Polystyrene Particles, Crosslinked, 8.0-12.9 µm
DNM-P016CR 10 mL

DiagPoly™ Plain Polystyrene Particles, Crosslinked, 8.0-12.9 µm

Sign In for Pricing
View Details
Anti-CD72 (Rabbit, Monoclonal)
A102486 100 µL

Anti-CD72 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Recombinant Human TWF1
P5692-01 50 µg

Recombinant Human TWF1

Sign In for Pricing
View Details