Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-5, Human

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GDF-5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-5-protein-human.html

Purity

98.00

Smiles

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Formula

8200 (Gene_ID) P43026 (A382-R501) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mybpc3 (NM_008653) Mouse Tagged ORF Clone
MG227579 10 µg

Mybpc3 (NM_008653) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ANA-12, TrkB antagonist
TBI2828-25MG 25 mg

ANA-12, TrkB antagonist

Sign In for Pricing
View Details
Ah Receptor (B-11) PE
sc-74571 PE 200 µg/mL

Ah Receptor (B-11) PE

Sign In for Pricing
View Details
CAMK1, CT (Calcium/Calmodulin-dependent Protein Kinase Type 1, CaM Kinase I, CaM-KI, CaM Kinase I alpha, CaMKI-alpha) (APC) discontinued
C1035-22A-APC 200 µL

CAMK1, CT (Calcium/Calmodulin-dependent Protein Kinase Type 1, CaM Kinase I, CaM-KI, CaM Kinase I alpha, CaMKI-alpha) (APC) discontinued

Sign In for Pricing
View Details
AP2 alpha (AP2A1) Human qPCR Primer Pair (NM_014203)
HP210693 200 Reactions

AP2 alpha (AP2A1) Human qPCR Primer Pair (NM_014203)

Sign In for Pricing
View Details
C11orf41 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0284106 1.0 µg DNA

C11orf41 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details