Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHA, Mouse (HEK293, His)

LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD (+) .LDHA Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDHA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LDHA Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-lactate-dehydrogenase-ldha-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF

Molecular Formula

16828 (Gene_ID) P06151 (M1-F332) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC5A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44235066 1.0 µg DNA

SLC5A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MATN1 Antibody
254062 0.1 mg

MATN1 Antibody

Sign In for Pricing
View Details
Vmn1r183 (NM_203489) Mouse Tagged ORF Clone
MR223699 10 µg

Vmn1r183 (NM_203489) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody
NBP2-04044 100 µL

Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody

Sign In for Pricing
View Details
Mouse SERPIND1 Protein, His Tag
E40MOP1133 20 µg

Mouse SERPIND1 Protein, His Tag

Sign In for Pricing
View Details
C2orf16 Rabbit Polyclonal Antibody (Biotin)
orb448844 100 µL

C2orf16 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details