Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-11, Human (sf9)

Kallikrein 11 Protein, Human (sf9) is a possible multifunctional protease and efficiently cleaves 'bz-Phe-Arg-4-methylcoumaryl-7-amide', a kallikrein substrate, and weakly cleaves other substrates for kallikrein and trypsin.

Product Specifications

Product Name Alternative

Kallikrein-11 Protein, Human (sf9), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-11-protein-human-sf9.html

Purity

95.0

Smiles

EFAATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAHHHHHHGSGSDDDDKETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

Molecular Formula

11012 (Gene_ID) Q9UBX7-2 (E51-N282) (Accession)

Molecular Weight

Approximately 35.0 kDa

References & Citations

[1]KLK11 kallikrein related peptidase 11 [ Homo sapiens (human) ]

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti Rat IgG Light Chain (HRP)
40R-1002 100 ug

Mouse anti Rat IgG Light Chain (HRP)

Sign In for Pricing
View Details
Anti-Siglec-5 Antibody-FITC (8A125)
TMAY-02064F-01 25 Tests

Anti-Siglec-5 Antibody-FITC (8A125)

Sign In for Pricing
View Details
Anti-Siglec-5 Antibody-FITC (8A125)
TMAY-02064F-02 100 Tests

Anti-Siglec-5 Antibody-FITC (8A125)

Sign In for Pricing
View Details
Aspg (NM_001081169) Mouse Tagged ORF Clone Lentiviral Particle
MR212540L3V 200 µL

Aspg (NM_001081169) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ACV Tripeptide TFA
orb3142422-01 10 mg

ACV Tripeptide TFA

Sign In for Pricing
View Details
ACV Tripeptide TFA
orb3142422-02 50 mg

ACV Tripeptide TFA

Sign In for Pricing
View Details