Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBP delta/CEBPD, Human (His-Myc)

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CEBP delta/CEBPD Protein, Human (His-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cebpd-protein-human-his-myc.html

Purity

94.00

Smiles

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Molecular Formula

1052 (Gene_ID) P49716 (S2-R269) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Ala-2-Chlorotrityl Resin
5-07995 5 g

H-Ala-2-Chlorotrityl Resin

Sign In for Pricing
View Details
C11ORF67 (AAMDC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E4]
TA803555AM 100 µL

C11ORF67 (AAMDC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E4]

Sign In for Pricing
View Details
PHTF2 ORF Vector (Human) (pORF)
ORF014068 1.0 µg DNA

PHTF2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Seretide
562024 10.0mg

Seretide

Sign In for Pricing
View Details
OR6F1 Human shRNA Plasmid Kit (Locus ID 343169)
TL310722 1 Kit

OR6F1 Human shRNA Plasmid Kit (Locus ID 343169)

Sign In for Pricing
View Details
Recombinant Human GSTA1 Protein, Untagged, E.coli-1mg
QP10657-1mg 1mg

Recombinant Human GSTA1 Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details