Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBP delta/CEBPD, Human (His-Myc)

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CEBP delta/CEBPD Protein, Human (His-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cebpd-protein-human-his-myc.html

Purity

94.00

Smiles

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Molecular Formula

1052 (Gene_ID) P49716 (S2-R269) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF496 (NM_032752) Human Recombinant Protein
TP303534 20 µg

ZNF496 (NM_032752) Human Recombinant Protein

Ask
View Details
Rps6kb1, CT (Rps6kb1, Ribosomal protein S6 kinase beta-1, 70kD ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, p70 ribosomal S6 kinase alpha) (MaxLight 550) discontinued
041260-ML550 100 µL

Rps6kb1, CT (Rps6kb1, Ribosomal protein S6 kinase beta-1, 70kD ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, p70 ribosomal S6 kinase alpha) (MaxLight 550) discontinued

Ask
View Details
SLC41A2 Antibody, FITC conjugated
A35048-100UG 100 µg

SLC41A2 Antibody, FITC conjugated

Ask
View Details
MC-4R Agonist 1
HY-U00396 1 Each

MC-4R Agonist 1

Ask
View Details
TPD52L2 Polyclonal Antibody, PE-Cy5 Conjugated
bs-6743R-PE-Cy5 100 µL

TPD52L2 Polyclonal Antibody, PE-Cy5 Conjugated

Ask
View Details