Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBP delta/CEBPD, Human (His-Myc)

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CEBP delta/CEBPD Protein, Human (His-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cebpd-protein-human-his-myc.html

Purity

94.00

Smiles

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Molecular Formula

1052 (Gene_ID) P49716 (S2-R269) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MDGA2 antibody
STJ117168 100 µl

Anti-MDGA2 antibody

Sign In for Pricing
View Details
Human MYBL1 knockout cell line
ABC-KH9703 1 Vial

Human MYBL1 knockout cell line

Sign In for Pricing
View Details
PCSK9 Antibody
MBS7113214-01 0.05 mL

PCSK9 Antibody

Sign In for Pricing
View Details
PCSK9 Antibody
MBS7113214-02 0.1 mL

PCSK9 Antibody

Sign In for Pricing
View Details
PCSK9 Antibody
MBS7113214-03 5x 0.1 mL

PCSK9 Antibody

Sign In for Pricing
View Details
UGT3A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2586408 1.0 µg DNA

UGT3A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details