Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr96 (NM_146514) Mouse Tagged Lenti ORF Clone
MR212995L4 10 µg

Olfr96 (NM_146514) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RNF39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40310111 3x 1.0 µg

RNF39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
A3GALT2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0014003 1.0 µg DNA

A3GALT2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Dectin-1 (C-type lectin domain family 7 member A, Dendritic cell-associated C-type lectin 1, DC-associated C-type lectin 1, Beta-glucan receptor, C-type lectin superfamily member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 405) discontinued
D1876-48M-ML405 100 µL

Dectin-1 (C-type lectin domain family 7 member A, Dendritic cell-associated C-type lectin 1, DC-associated C-type lectin 1, Beta-glucan receptor, C-type lectin superfamily member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans Y71F9B.2 Polyclonal Antibody
MBS9008596 Inquire

Rabbit anti-Caenorhabditis elegans Y71F9B.2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Catenin delta-2, Ctnnd2 ELISA KIT
ELI-32886m 96 Tests

Mouse Catenin delta-2, Ctnnd2 ELISA KIT

Sign In for Pricing
View Details