Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trilostane Impurity 10
RM-T183510-01 10 mg

Trilostane Impurity 10

Sign In for Pricing
View Details
Trilostane Impurity 10
RM-T183510-02 100 mg

Trilostane Impurity 10

Sign In for Pricing
View Details
Trilostane Impurity 10
RM-T183510-03 25 mg

Trilostane Impurity 10

Sign In for Pricing
View Details
Trilostane Impurity 10
RM-T183510-04 50 mg

Trilostane Impurity 10

Sign In for Pricing
View Details
Lentiviral human NELFA shRNA (UAS) - Lentiviral human NELFA shRNA (UAS, RFP) (25)
GTR15329318 1 Vial

Lentiviral human NELFA shRNA (UAS) - Lentiviral human NELFA shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SAFB2 (KIAA0138, Scaffold Attachment Factor B2, SAF-B2) (AP) discontinued
132951-AP 100 µL

SAFB2 (KIAA0138, Scaffold Attachment Factor B2, SAF-B2) (AP) discontinued

Sign In for Pricing
View Details