Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-4649-5p Vector
mh31572 500 ng

LentimiRa-Off-hsa-miR-4649-5p Vector

Sign In for Pricing
View Details
Anti-Mouse CD172a (P84) In Vivo Antibody - Low Endotoxin
ICH1076-50mg 50 mg

Anti-Mouse CD172a (P84) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
GTF3C3 (NM_012086) Human Over-expression Lysate
LH08651V 100 µg

GTF3C3 (NM_012086) Human Over-expression Lysate

Sign In for Pricing
View Details
Lamin A (LMNA) (NM_005572) Human Over-expression Lysate
LH07768V 100 µg

Lamin A (LMNA) (NM_005572) Human Over-expression Lysate

Sign In for Pricing
View Details
SLCO1A2 Antibody, FITC conjugated
A35102-100UG 100 µg

SLCO1A2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Monkey PLN (Phospholamban) ELISA Kit
MBS2508005-01 24 Tests

Monkey PLN (Phospholamban) ELISA Kit

Sign In for Pricing
View Details