BTN2A2, Human (HEK293, Fc)
BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].
Product Specifications
Product Name Alternative
BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html
Purity
98.0
Smiles
QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV
Molecular Formula
10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)
Molecular Weight
55-65 kDa
References & Citations
[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
035569-ML750 100 µL
FBXW11, ID (FBXW11, BTRCP2, FBW1B, FBXW1B, KIAA0696, F-box/WD repeat-containing protein 11, F-box and WD repeats protein beta-TrCP2, F-box/WD repeat-containing protein 1B, Homologous to Slimb protein) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS9915427-01 48 Well
Camel Zinc Finger Protein Castor Homolog 1 (CASZ1) ELISA Kit
Sign In for Pricing
View Details