Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS2P35 ORF Vector (Human) (pORF)
ORF031590 1.0 µg DNA

RPS2P35 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse recombinant IL-9 (Interleukin-9) protein, AF
PROTP15247-2-5ug 5 µg

Mouse recombinant IL-9 (Interleukin-9) protein, AF

Sign In for Pricing
View Details
Lentiviral human PDZD4 shRNA (UAS) - Lentiviral human PDZD4 shRNA (UAS, RFP) (100)
GTR15331911 1 Vial

Lentiviral human PDZD4 shRNA (UAS) - Lentiviral human PDZD4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) SSRP1 Polyclonal Antibody
MBS9007545 Inquire

Rabbit anti-Zea mays (Maize) SSRP1 Polyclonal Antibody

Sign In for Pricing
View Details
LILRA2 (NM_006866) Human Tagged Lenti ORF Clone
RC205626L3 10 µg

LILRA2 (NM_006866) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SIL1, ID (Nucleotide Exchange Factor SIL1, BiP-associated Protein, BAP, UNQ545/PRO836) (Azide free) (HRP)
MBS6499527-01 0.2 mL

SIL1, ID (Nucleotide Exchange Factor SIL1, BiP-associated Protein, BAP, UNQ545/PRO836) (Azide free) (HRP)

Sign In for Pricing
View Details