Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRN siRNA (Human)
CRJ7164-01 15 nmol

TPRN siRNA (Human)

Sign In for Pricing
View Details
TPRN siRNA (Human)
CRJ7164-02 30 nmol

TPRN siRNA (Human)

Sign In for Pricing
View Details
RPSAP12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2064106 1.0 µg DNA

RPSAP12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC MSRQ Polyclonal Antibody
MBS7166963 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC MSRQ Polyclonal Antibody

Sign In for Pricing
View Details
Tacr3 Rat siRNA Oligo Duplex (Locus ID 24808)
SR506043 1 Kit

Tacr3 Rat siRNA Oligo Duplex (Locus ID 24808)

Sign In for Pricing
View Details
PKM2 Polyclonal Antibody
RA21446-01 50 µL

PKM2 Polyclonal Antibody

Sign In for Pricing
View Details