Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDS Adenovirus (Mouse)
43276054 1.0 mL

SDS Adenovirus (Mouse)

Sign In for Pricing
View Details
Star sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3919003 1.0 µg DNA

Star sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Mouse Tmprss5 Protein, His (Fc)-Avi-tagged
Tmprss5-9457M 50 µg

Recombinant Mouse Tmprss5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
TMBIM4 sgRNA CRISPR Lentivector (Human) (Target 2)
K2382803 1.0 µg DNA

TMBIM4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Olfr1022 sgRNA CRISPR Lentivector set (Mouse)
K4191101 3x 1.0 µg

Olfr1022 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Anti-CD53 antibody
SL13625R-01 50 µL

Rabbit Anti-CD53 antibody

Sign In for Pricing
View Details