Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CRP+HsCRP Lateral Flow Assay Kit
E-HD-C077 20 Tests

Human CRP+HsCRP Lateral Flow Assay Kit

Sign In for Pricing
View Details
Human Thy1 Cell Surface Antigen (Thy1) ELISA Kit
RD-Thy1-Hu-01 96 Tests

Human Thy1 Cell Surface Antigen (Thy1) ELISA Kit

Sign In for Pricing
View Details
Human Thy1 Cell Surface Antigen (Thy1) ELISA Kit
RD-Thy1-Hu-02 48 Tests

Human Thy1 Cell Surface Antigen (Thy1) ELISA Kit

Sign In for Pricing
View Details
RRM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]
TA810548BM 100 µL

RRM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]

Sign In for Pricing
View Details
SIGMAR1 Adenovirus (Rat)
43781056 1.0 mL

SIGMAR1 Adenovirus (Rat)

Sign In for Pricing
View Details
TRO Protein Vector (Human) (pPB-C-His)
PV044077 500 ng

TRO Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details