Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atrial natriuretic factor Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61685R-BF555-01 20 µL

Atrial natriuretic factor Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Atrial natriuretic factor Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61685R-BF555-02 100 µL

Atrial natriuretic factor Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (MaxLight 750) discontinued
C2261-40T-ML750 100 µL

CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Neuromedin B 25mg
A22780-25 25 mg

Neuromedin B 25mg

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase-like protein 2 (chs2), partial
MBS1244442-01 1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Chitin synthase-like protein 2 (chs2), partial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase-like protein 2 (chs2), partial
MBS1244442-02 1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Chitin synthase-like protein 2 (chs2), partial

Sign In for Pricing
View Details