Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab43 (NM_133717) Mouse Tagged ORF Clone Lentiviral Particle
MR216793L3V 200 µL

Rab43 (NM_133717) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal Abraxas Antibody [DyLight 680]
NBP1-76827FR 0.1 mL

Rabbit Polyclonal Abraxas Antibody [DyLight 680]

Sign In for Pricing
View Details
Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit
MBS7266100-01 48 Well

Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit
MBS7266100-02 96 Well

Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit
MBS7266100-03 5x 96 Well

Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit
MBS7266100-04 10x 96 Well

Sheep Soluble Fms-Like Tyrosine Kinase Receptor 2/sVEGFR2 ELISA Kit

Sign In for Pricing
View Details