Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2, Human (HEK293, Fc)

BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html

Purity

98.0

Smiles

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Molecular Formula

10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centromere Protein O (CENPO) Antibody
abx340030-01 100 µg

Centromere Protein O (CENPO) Antibody

Sign In for Pricing
View Details
Centromere Protein O (CENPO) Antibody
abx340030-02 1 mg

Centromere Protein O (CENPO) Antibody

Sign In for Pricing
View Details
Dextran 70 For Molecular Biology-MW-64000-76000
924715 25 g

Dextran 70 For Molecular Biology-MW-64000-76000

Sign In for Pricing
View Details
Recombinant Human NCAM1 Protein, His-tagged
NCAM1-02H 10 µg

Recombinant Human NCAM1 Protein, His-tagged

Sign In for Pricing
View Details
KIAA2002 (NKF3 Kinase Family Member, FLJ21140, FLJ34483, KIAA2002) (HRP)
MBS6179575-01 0.1 mL

KIAA2002 (NKF3 Kinase Family Member, FLJ21140, FLJ34483, KIAA2002) (HRP)

Sign In for Pricing
View Details
KIAA2002 (NKF3 Kinase Family Member, FLJ21140, FLJ34483, KIAA2002) (HRP)
MBS6179575-02 5x 0.1 mL

KIAA2002 (NKF3 Kinase Family Member, FLJ21140, FLJ34483, KIAA2002) (HRP)

Sign In for Pricing
View Details