BTN2A2, Human (HEK293, Fc)
BTN2A2 Protein, Human (HEK293, Fc) is a recombinant human BTN2A2 produced in HEK293 cells, with Fc tag. BTN2A2 is a member of butyrophilin family[1].
Product Specifications
Product Name Alternative
BTN2A2 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btn2a2-protein-human-hek293-fc.html
Purity
98.0
Smiles
QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV
Molecular Formula
10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)
Molecular Weight
55-65 kDa
References & Citations
[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6417474-01 0.1 mL
FMR1 (Fragile X Mental Retardation Protein 1, FMRP, FRAXA, MGC87458, POF, POF1) (MaxLight 750)
Sign In for Pricing
View Details MBS6417474-02 5x 0.1 mL
FMR1 (Fragile X Mental Retardation Protein 1, FMRP, FRAXA, MGC87458, POF, POF1) (MaxLight 750)
Sign In for Pricing
View Details 
K3248503 1.0 µg DNA
AF067061 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
K3695307 1.0 µg DNA
Plxnb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details NB100-58797C 0.1 mL
Rabbit Polyclonal Ataxin-2 Antibody [DyLight 650]
Sign In for Pricing
View Details