Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAEP, Human (HEK293, Myc, His)

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, Myc, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

PAEP Protein, Human (HEK293, Myc, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/paep-protein-human-hek-293-myc-his.html

Purity

93.00

Smiles

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Molecular Formula

5047 (Gene_ID) P09466-1 (M19-F180) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Castanospermine
MBS5764555 Inquire

Castanospermine

Sign In for Pricing
View Details
Goose Inverted Formin-2 (INF2) ELISA Kit
MBS9903881 Inquire

Goose Inverted Formin-2 (INF2) ELISA Kit

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E7]
TA807642BM 100 µL

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E7]

Sign In for Pricing
View Details
Vmn1r215 Recombinant Protein (Mouse)
RP184163 100 µg

Vmn1r215 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Paqr4 Rabbit Polyclonal Antibody
TA357077 100 µL

Paqr4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila exeG Protein (aa 9-143)
VAng-Lsx0643-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Hydrophila exeG Protein (aa 9-143)

Sign In for Pricing
View Details