Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR1, Mouse (HEK293, His)

FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FOLR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMS

Molecular Formula

14275 (Gene_ID) P35846 (T25-S232) (Accession)

Molecular Weight

33-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyFi Mix, 2x
BIO-25049 100 Reactions

MyFi Mix, 2x

Sign In for Pricing
View Details
Poliovirus Receptor (PVR) rat monoclonal antibody, clone TX21, FITC
AM26504FC-N 100 µL

Poliovirus Receptor (PVR) rat monoclonal antibody, clone TX21, FITC

Sign In for Pricing
View Details
Mouse Monoclonal SIL1 Antibody (OTI3E3) [Janelia Fluor 646]
NBP2-74193JF646 0.1 mL

Mouse Monoclonal SIL1 Antibody (OTI3E3) [Janelia Fluor 646]

Sign In for Pricing
View Details
BAG5 Rabbit Polyclonal Antibody (HRP)
orb2095445 100 µL

BAG5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
HSP60 discontinued
390181 200 µL

HSP60 discontinued

Sign In for Pricing
View Details
MYCS siRNA (Rat)
CRR0197-01 15 nmol

MYCS siRNA (Rat)

Sign In for Pricing
View Details