Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Rat

FGF-18 Protein, Rat is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Product Specifications

Product Name Alternative

FGF-18 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-rat.html

Purity

95.00

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR

Molecular Formula

29369 (Gene_ID) O88182 (E28-R199) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)
MBS6498516-01 0.1 mL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)

Ask
View Details
SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)
MBS6498516-02 5x 0.1 mL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)

Ask
View Details
Lentiviral human CYP3A43 shRNA (UAS) - Lentiviral human CYP3A43 shRNA (UAS, RFP) plasmid
GTR15143521 1 Vial

Lentiviral human CYP3A43 shRNA (UAS) - Lentiviral human CYP3A43 shRNA (UAS, RFP) plasmid

Ask
View Details
ATPAF1 (NM_001256418) Human Tagged ORF Clone
RC233369 10 µg

ATPAF1 (NM_001256418) Human Tagged ORF Clone

Ask
View Details
Mouse Monoclonal NM23-H2/NME2 Antibody (4G7A8)
NBP2-52519-0.025mg 0.025 mg

Mouse Monoclonal NM23-H2/NME2 Antibody (4G7A8)

Ask
View Details
Goat C-type lectin domain family 7 member A (CLEC7A) ELISA Kit
MBS7244117-01 48 Well

Goat C-type lectin domain family 7 member A (CLEC7A) ELISA Kit

Ask
View Details