Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Rat

FGF-18 Protein, Rat is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Product Specifications

Product Name Alternative

FGF-18 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-rat.html

Purity

95.00

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR

Molecular Formula

29369 (Gene_ID) O88182 (E28-R199) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PHOX1 Polyclonal Antibody
MBS7146565 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PHOX1 Polyclonal Antibody

Ask
View Details
FGFR2 Blocking Peptide
33R-4425 100 ug

FGFR2 Blocking Peptide

Ask
View Details
Cotton Rat CD4 Affinity Purified Polyclonal Ab
AF6676 100 µg

Cotton Rat CD4 Affinity Purified Polyclonal Ab

Ask
View Details
Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)
MBS7015676-01 0.02 mg

Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)

Ask
View Details
Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)
MBS7015676-02 0.1 mg

Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)

Ask
View Details
Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)
MBS7015676-03 5x 0.1 mg

Recombinant Xenopus laevis Gap junction alpha-1 protein (gja1)

Ask
View Details