Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD2, Human (His, Myc)

DRD2 Protein, Human (His, Myc) is the recombinant human-derived DRD2 protein, expressed by E. coli, with N-10*His & C-Myc tag.

Product Specifications

Product Name Alternative

DRD2 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/drd2-protein-human-his-myc.html

Purity

90.00

Smiles

IVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQ

Molecular Formula

1813 (Gene_ID) P14416 (I214-Q373) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin 2 Rabbit Polyclonal Antibody
HA500106 100 µL

Gemin 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF2 Mouse Monoclonal Antibody [Clone ID: F-3]
AM09157PU-N 500 µg

FGF2 Mouse Monoclonal Antibody [Clone ID: F-3]

Sign In for Pricing
View Details
Peroxidase Labeled Lectin Kit #1
HLK-001 1 mg

Peroxidase Labeled Lectin Kit #1

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565602 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
2-Propyl-(E)-2-pentenoic Acid
TRC-P839513-25MG 25 mg

2-Propyl-(E)-2-pentenoic Acid

Sign In for Pricing
View Details
Azurocidin (AZU1) (NM_001700) Human Over-expression Lysate
LC419800 20 µg

Azurocidin (AZU1) (NM_001700) Human Over-expression Lysate

Sign In for Pricing
View Details