Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Trefoil factor 3 (TFF3)

Product Specifications

Product Name Alternative

(Intestinal trefoil factor)

Abbreviation

Recombinant Dog TFF3 protein

Gene Name

TFF3

UniProt

Q863B4

Expression Region

24-80aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.2 kDa

References & Citations

"Canine trefoil factor 3 (TFF3) mRNA from colonic mucosa." Campbell B.G., Jabbes M. Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hsp90 beta Antibody
RC-15322-01 50 μL

Recombinant Hsp90 beta Antibody

Sign In for Pricing
View Details
Recombinant Hsp90 beta Antibody
RC-15322-02 100 µL

Recombinant Hsp90 beta Antibody

Sign In for Pricing
View Details
Recombinant Hsp90 beta Antibody
RC-15322-03 1 mL

Recombinant Hsp90 beta Antibody

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), Biotin conjugate, 0.1mg/mL
BNCB1082-100 1x 100 µL

MHC II (HLA-DRA) (19-26.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COL6A6 Human Gene Knockout Kit (CRISPR)
KN422036 1 Kit

COL6A6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
8H9 Biosimilar - Research Grade
ICH5118-10mg 10 mg (2x 5 mg)

8H9 Biosimilar - Research Grade

Sign In for Pricing
View Details