Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidyl peptidase 9 (DPP9), partial

Product Specifications

Product Name Alternative

(DP9) (Dipeptidyl peptidase IV-related protein 2) (DPRP-2) (Dipeptidyl peptidase IX) (DPP IX) (Dipeptidyl peptidase-like protein 9) (DPLP9)

Abbreviation

Recombinant Human DPP9 protein, partial

Gene Name

DPP9

UniProt

Q86TI2

Expression Region

585-788aa

Organism

Homo sapiens (Human)

Target Sequence

LHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVAL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. Acts as a key inhibitor of caspase-1-dependent monocyte and macrophage pyroptosis in resting cells by preventing activation of NLRP1 and CARD8. Sequesters the cleaved C-terminal part of NLRP1 and CARD8, which respectively constitute the active part of the NLRP1 and CARD8 inflammasomes, in a ternary complex, thereby preventing their oligomerization and activation. The dipeptidyl peptidase activity is required to suppress NLRP1 and CARD8; however, neither NLRP1 nor CARD8 are bona fide substrates of DPP9, suggesting the existence of substrate (s) required for NLRP1 and CARD8 inhibition.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.7 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UBTD1 (UBTD1, Ubiquitin domain-containing protein 1) (MaxLight 750) discontinued
043555-ML750 100 µL

UBTD1 (UBTD1, Ubiquitin domain-containing protein 1) (MaxLight 750) discontinued

Ask
View Details
ADAMTS16 (NM_139056) Human Over-expression Lysate
LH13931V 100 µg

ADAMTS16 (NM_139056) Human Over-expression Lysate

Ask
View Details
COG3 (SEC34, Conserved Oligomeric Golgi Complex Subunit 3, COG Complex Subunit 3, Component of Oligomeric Golgi Complex 3, Vesicle-docking Protein SEC34 Homolog, p94) APC
MBS6135978-01 0.1 mL

COG3 (SEC34, Conserved Oligomeric Golgi Complex Subunit 3, COG Complex Subunit 3, Component of Oligomeric Golgi Complex 3, Vesicle-docking Protein SEC34 Homolog, p94) APC

Ask
View Details
COG3 (SEC34, Conserved Oligomeric Golgi Complex Subunit 3, COG Complex Subunit 3, Component of Oligomeric Golgi Complex 3, Vesicle-docking Protein SEC34 Homolog, p94) APC
MBS6135978-02 5x 0.1 mL

COG3 (SEC34, Conserved Oligomeric Golgi Complex Subunit 3, COG Complex Subunit 3, Component of Oligomeric Golgi Complex 3, Vesicle-docking Protein SEC34 Homolog, p94) APC

Ask
View Details
LE/AF Purified Anti-Mouse IL-6 Monoclonal Antibody
MBS2559496-01 0.025 mg

LE/AF Purified Anti-Mouse IL-6 Monoclonal Antibody

Ask
View Details
LE/AF Purified Anti-Mouse IL-6 Monoclonal Antibody
MBS2559496-02 0.1 mg

LE/AF Purified Anti-Mouse IL-6 Monoclonal Antibody

Ask
View Details