Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paraphysa scrofa Kappa-theraphotoxin-Ps1b

Product Specifications

Product Name Alternative

(Kappa-TRTX-Ps1b) (PaTX2) (Phrixotoxin-2)

Abbreviation

Recombinant Paraphysa scrofa Kappa-theraphotoxin-Ps1b protein

UniProt

P61231

Expression Region

1-31aa

Organism

Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)

Target Sequence

YCQKWMWTCDEERKCCEGLVCRLWCKRIINM

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Potent and specific blocker of Kv4.2/KCND2 (IC (50) =34 nM) and Kv4.3/KCND3 (IC (50) =71 nM) potassium channels . Acts by altering the gating properties of these channels .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

References & Citations

"Effects of phrixotoxins on the Kv4 family of potassium channels and implications for the role of Ito1 in cardiac electrogenesis." Diochot S., Drici M.-D., Moinier D., Fink M., Lazdunski M. Br. J. Pharmacol. 126:251-263 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXR1, NT (FXR1, Fragile X mental retardation syndrome-related protein 1) (FITC)
MBS6300469-01 0.2 mL

FXR1, NT (FXR1, Fragile X mental retardation syndrome-related protein 1) (FITC)

Sign In for Pricing
View Details
FXR1, NT (FXR1, Fragile X mental retardation syndrome-related protein 1) (FITC)
MBS6300469-02 5x 0.2 mL

FXR1, NT (FXR1, Fragile X mental retardation syndrome-related protein 1) (FITC)

Sign In for Pricing
View Details
PPP1R10 Rabbit pAb
orb2711106-01 50 µL

PPP1R10 Rabbit pAb

Sign In for Pricing
View Details
PPP1R10 Rabbit pAb
orb2711106-02 100 µL

PPP1R10 Rabbit pAb

Sign In for Pricing
View Details
AP2A1 Antibody
orb352983-01 50 μL

AP2A1 Antibody

Sign In for Pricing
View Details
AP2A1 Antibody
orb352983-02 100 µL

AP2A1 Antibody

Sign In for Pricing
View Details