Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-2/CLEC6A, Mouse (HEK293, His)

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Dectin-2/CLEC6A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dectin-2-clec6a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL

Molecular Formula

56620 (Gene_ID) Q9JKF4-1/NP_064385.1 (I44-L209) (Accession)

Molecular Weight

Approximately 21-23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF154 antibody
FNab09660 100 µg

ZNF154 antibody

Sign In for Pricing
View Details
MIPEP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]
TA800237BM 100 µL

MIPEP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]

Sign In for Pricing
View Details
2-(tert-Butyl)-4-ethylphenol
TRC-B563760-5G 5 g

2-(tert-Butyl)-4-ethylphenol

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pleura
CB521575 1 Block

Frozen Tissue Blocks, Pleura

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS627370 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF488A conjugate, 0.1mg/mL
BNC881864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details