Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-2/CLEC6A, Mouse (HEK293, His)

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Dectin-2/CLEC6A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dectin-2-clec6a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL

Molecular Formula

56620 (Gene_ID) Q9JKF4-1/NP_064385.1 (I44-L209) (Accession)

Molecular Weight

Approximately 21-23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TAF7L activation kit by CRISPRa
GA110109 1 Kit

Human TAF7L activation kit by CRISPRa

Sign In for Pricing
View Details
Human CWC22 activation kit by CRISPRa
GA111697 1 Kit

Human CWC22 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Acetyl-cys(1)-calcitonin Salmon Trifluoroacetic Acid Salt
TRC-A168465-25MG 25 mg

N-Acetyl-cys(1)-calcitonin Salmon Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Recombinant Mouse Frizzled-10/FZD10 Protein (Fc Tag)
PKSM040610 100 µg

Recombinant Mouse Frizzled-10/FZD10 Protein (Fc Tag)

Sign In for Pricing
View Details
Slc35e1 Mouse Gene Knockout Kit (CRISPR)
KN516068 1 Kit

Slc35e1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Nitro-p-anisidine-15N
TRC-N491802-10MG 10 mg

2-Nitro-p-anisidine-15N

Sign In for Pricing
View Details