Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-2/CLEC6A, Mouse (HEK293, His)

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Dectin-2/CLEC6A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dectin-2-clec6a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL

Molecular Formula

56620 (Gene_ID) Q9JKF4-1/NP_064385.1 (I44-L209) (Accession)

Molecular Weight

Approximately 21-23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p23 (PTGES3) Human Gene Knockout Kit (CRISPR)
KN401254 1 Kit

p23 (PTGES3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADIG (NM_001018082) Human Over-expression Lysate
LY422646 100 µg

ADIG (NM_001018082) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated lris hybrid Lectin (Dutch Iris) -IRA-,  40nm
GP-8010-40 1 mL

Colloidal Gold Conjugated lris hybrid Lectin (Dutch Iris) -IRA-, 40nm

Sign In for Pricing
View Details
Anti-MBP Tag Antibody
KC-19264-01 50 μL

Anti-MBP Tag Antibody

Sign In for Pricing
View Details
Anti-MBP Tag Antibody
KC-19264-02 100 µL

Anti-MBP Tag Antibody

Sign In for Pricing
View Details
Anti-MBP Tag Antibody
KC-19264-03 1 mL

Anti-MBP Tag Antibody

Sign In for Pricing
View Details