Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-2/CLEC6A, Mouse (HEK293, His)

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Dectin-2/CLEC6A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dectin-2-clec6a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL

Molecular Formula

56620 (Gene_ID) Q9JKF4-1/NP_064385.1 (I44-L209) (Accession)

Molecular Weight

Approximately 21-23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1galt1c1 Mouse Gene Knockout Kit (CRISPR)
KN502341 1 Kit

C1galt1c1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Fmoc-L-alanine
TRC-F619945-250G 250 g

N-Fmoc-L-alanine

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), CF640R conjugate, 0.1mg/mL
BNC401214-100 1x 100 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR559061 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)
PKSH031600-01 50 µg

Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)
PKSH031600-02 500 µg

Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)

Sign In for Pricing
View Details