Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-G, Human (His-SUMO)

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (His-SUMO) is the recombinant human-derived HLA-G protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

HLA-G Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-g-protein-human-his-sumo.html

Smiles

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Molecular Formula

3135 (Gene_ID) P17693-1 (G25-D338) (Accession)

Molecular Weight

Approximately 51.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SECTM1 Polyclonal Antibody
MF-0088858-01 50 µL

Anti-SECTM1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SECTM1 Polyclonal Antibody
MF-0088858-02 100 µL

Anti-SECTM1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SECTM1 Polyclonal Antibody
MF-0088858-03 200 µL

Anti-SECTM1 Polyclonal Antibody

Sign In for Pricing
View Details
XPR1 (NM_001135669) Human Tagged Lenti ORF Clone
RC227202L3 10 µg

XPR1 (NM_001135669) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BCL2L1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV682793 1.0 µg DNA

BCL2L1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Phospho-Rb2 p130 Rabbit Monoclonal Antibody
E56G3709 100 µL

Phospho-Rb2 p130 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details