CD160, Rhesus macaque (HEK293, His)
CD160 Protein, Rhesus macaque (HEK293, His) is a recombinant rhesus macaque CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1][2].
Product Specifications
Product Name Alternative
CD160 Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd160-protein-rhesus-macaque-hek293-his.html
Smiles
MLMETGRGCCALAILLAIVDIQSGGCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTLHHHHHH
Molecular Formula
696832 (Gene_ID) G7MG20 (G25-L158) (Accession)
Molecular Weight
Approximately 16-30 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Cai G, et, al. The CD160, BTLA, LIGHT/HVEM pathway: a bidirectional switch regulating T-cell activation. Immunol Rev. 2009 May;229 (1) :244-58.|[2]Kaye J. CD160 and BTLA: LIGHTs out for CD4+ T cells. Nat Immunol. 2008 Feb;9 (2) :122-4.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
