MCP-1/CCL2, Mouse (HEK293, His)
MCP-1/CCL2 Protein, Mouse (HEK293, His) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293, His) is a mouse MCP-1/CCL2 expressed by HEK293 with a His tag at the C-terminus[1].
Product Specifications
Product Name Alternative
MCP-1/CCL2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-1-ccl2-protein-mouse-hek-293-his.html
Smiles
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Molecular Formula
20296 (Gene_ID) P10148 (Q24-N148) (Accession)
Molecular Weight
Approximately 20-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
