Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAG, Human (P.pastoris, His)

SAG proteins play a crucial role in phototransduction, regulating signal transduction by binding to light-activated and phosphorylated rhodopsin (RHO) . It terminates RHO signaling by competitively interacting with G proteins at the same binding site on RHO. SAG Protein, Human (P.pastoris, His) is the recombinant human-derived SAG protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SAG Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sag-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE

Molecular Formula

6295 (Gene_ID) P10523 (M1-E405) (Accession)

Molecular Weight

Approximately 47.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD94 AAV siRNA Pooled Vector
44949161 1.0 µg

SNORD94 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ACADL antibody
70R-2510 100 µL

ACADL antibody

Sign In for Pricing
View Details
PDHA1 Human siRNA Oligo Duplex (Locus ID 5160)
SR303425 1 Kit

PDHA1 Human siRNA Oligo Duplex (Locus ID 5160)

Sign In for Pricing
View Details
Fibroblast growth factor receptor 2 Antibody / FGFR2
RQ7691 100 µg

Fibroblast growth factor receptor 2 Antibody / FGFR2

Sign In for Pricing
View Details
QRFPR-set siRNA/shRNA/RNAi Lentivector (Human)
38270091 4x 500 ng

QRFPR-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Beta Adrenergic Receptor Kinase (BARK), Recombinant, Human, His-Tag, GST-Tag
056485-01 10 µg

Beta Adrenergic Receptor Kinase (BARK), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details