Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX1/Peroxiredoxin-1, Human (His)

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX1/Peroxiredoxin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx1-protein-human-his.html

Purity

98.0

Smiles

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Molecular Formula

5052 (Gene_ID) Q06830 (M1-K199) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit
MBS9331774-01 48 Well

Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit

Sign In for Pricing
View Details
Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit
MBS9331774-02 96 Well

Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit

Sign In for Pricing
View Details
Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit
MBS9331774-03 5x 96 Well

Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit

Sign In for Pricing
View Details
Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit
MBS9331774-04 10x 96 Well

Human Retinal guanylyl cyclase 1, GUCY2D ELISA Kit

Sign In for Pricing
View Details
Vmn2r47 (NM_001105151) Mouse Tagged ORF Clone
MG214345 10 µg

Vmn2r47 (NM_001105151) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C1orf131 Human qPCR Primer Pair (NM_152379)
HP217652 200 Reactions

C1orf131 Human qPCR Primer Pair (NM_152379)

Sign In for Pricing
View Details