Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX1/Peroxiredoxin-1, Human (His)

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX1/Peroxiredoxin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx1-protein-human-his.html

Purity

98.0

Smiles

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Molecular Formula

5052 (Gene_ID) Q06830 (M1-K199) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV Pret-140 Protein (aa 1-301)
VAng-2432Lsx-50g 50 µg

Recombinant ASFV Pret-140 Protein (aa 1-301)

Sign In for Pricing
View Details
LRP10 Protein Vector (Rat) (pPB-N-His)
PV279887 500 ng

LRP10 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Armenian Hamster Monoclonal CD81 Antibody (2F7) [Janelia Fluor 525]
NBP1-28136JF525 0.25 mL

Armenian Hamster Monoclonal CD81 Antibody (2F7) [Janelia Fluor 525]

Sign In for Pricing
View Details
Lentiviral human RSU1 sgRNA gene knockout kit - Lentiviral human RSU1 sgRNA gene knockout kit (25)
GTR15397644 1 Vial

Lentiviral human RSU1 sgRNA gene knockout kit - Lentiviral human RSU1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
DNAJB5 (NM_001135004) Human Tagged ORF Clone Lentiviral Particle
RC225584L3V 200 µL

DNAJB5 (NM_001135004) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPL29P2 Protein Vector (Human) (pPB-C-His)
PV121962 500 ng

RPL29P2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details