Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX1/Peroxiredoxin-1, Human (His)

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX1/Peroxiredoxin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx1-protein-human-his.html

Purity

98.0

Smiles

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Molecular Formula

5052 (Gene_ID) Q06830 (M1-K199) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123UL-01 25 µg

Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123UL-02 100 µg

Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
ER780 Rat IgG2a, κ Isotype Control
JOT22809F 25μg

ER780 Rat IgG2a, κ Isotype Control

Sign In for Pricing
View Details
TRNAG5 Protein Vector (Human) (pPB-C-His)
PV138934 500 ng

TRNAG5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Beclin 2 Antibody: Biotin
MBS809393-01 0.1 mg

Beclin 2 Antibody: Biotin

Sign In for Pricing
View Details
Beclin 2 Antibody: Biotin
MBS809393-02 5x 0.1 mg

Beclin 2 Antibody: Biotin

Sign In for Pricing
View Details