Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX1/Peroxiredoxin-1, Human (His)

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX1/Peroxiredoxin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx1-protein-human-his.html

Purity

98.0

Smiles

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Molecular Formula

5052 (Gene_ID) Q06830 (M1-K199) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRY1 AAV Vector (Mouse) (CMV)
45398104 1 µg

SPRY1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Lentiviral mouse Mt3 shRNA (UAS) - Lentiviral mouseMt3 shRNA (UAS, GFP) (25)
GTR15250184 1 Vial

Lentiviral mouse Mt3 shRNA (UAS) - Lentiviral mouseMt3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TMEM221 (NM_001190844) Human Tagged Lenti ORF Clone
RC231134L4 10 µg

TMEM221 (NM_001190844) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal BAP1 Antibody (BAP1/2431) - Azide and BSA Free
NBP3-08477 100 µg

Mouse Monoclonal BAP1 Antibody (BAP1/2431) - Azide and BSA Free

Sign In for Pricing
View Details
Phospho-Histone H3 Antibody (pS10)
F48401-0.2ML 0.2 mL

Phospho-Histone H3 Antibody (pS10)

Sign In for Pricing
View Details
SESN2 (sestrin 2, DKFZp761M0212, DKFZp761M02121, HI95, SES2, SEST2) (MaxLight 750)
MBS6240492-01 0.1 mL

SESN2 (sestrin 2, DKFZp761M0212, DKFZp761M02121, HI95, SES2, SEST2) (MaxLight 750)

Sign In for Pricing
View Details