Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX1/Peroxiredoxin-1, Human (His)

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX1/Peroxiredoxin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx1-protein-human-his.html

Purity

98.0

Smiles

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Molecular Formula

5052 (Gene_ID) Q06830 (M1-K199) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ada/Adenosine deaminase ELISA Kit
E0026Ra 96 Tests

Rat Ada/Adenosine deaminase ELISA Kit

Sign In for Pricing
View Details
RGD1564114 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39352126 3x 1.0µg DNA

RGD1564114 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
ARHGEF1 discontinued
386081 200 µL

ARHGEF1 discontinued

Sign In for Pricing
View Details
KRT18P23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1172405 3x 1.0 µg

KRT18P23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Aurantinidin Chloride
441919-01 2.5 mg

Aurantinidin Chloride

Sign In for Pricing
View Details
Aurantinidin Chloride
441919-02 5 mg

Aurantinidin Chloride

Sign In for Pricing
View Details