Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX1/Peroxiredoxin-1, Human (His)

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX1/Peroxiredoxin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx1-protein-human-his.html

Purity

98.0

Smiles

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Molecular Formula

5052 (Gene_ID) Q06830 (M1-K199) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Abscessus nrdR Protein (aa 1-154)
VAng-Yyj5502-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Abscessus nrdR Protein (aa 1-154)

Sign In for Pricing
View Details
PLXNA2 Antibody
A31458-50UL 50 μL

PLXNA2 Antibody

Sign In for Pricing
View Details
Rrh 3'UTR Luciferase Stable Cell Line
TU219734 1.0 mL

Rrh 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Heat Shock Protein 40,Hsp-40 ELISA Kit
CN-02742M1 96T

Mouse Heat Shock Protein 40,Hsp-40 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal TIMP-2 Antibody (8R5Q2)
NBP3-16074-100ul 100 µL

Rabbit Monoclonal TIMP-2 Antibody (8R5Q2)

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H+L), Mouse/Human ads-PE
4050-09S 0.25 mg

Goat Anti-Rabbit IgG (H+L), Mouse/Human ads-PE

Sign In for Pricing
View Details