ISG15/UCRP, Human (His)
ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
ISG15/UCRP Protein, Human (C-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html
Purity
98.00
Smiles
GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
Molecular Formula
9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)
Molecular Weight
Approximately 17.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9338472-01 48 Well
Human NGFI-A-binding protein 1, NAB1 ELISA Kit
Sign In for Pricing
View Details MBS9338472-02 96 Well
Human NGFI-A-binding protein 1, NAB1 ELISA Kit
Sign In for Pricing
View Details 
MBS9338472-03 5x 96 Well
Human NGFI-A-binding protein 1, NAB1 ELISA Kit
Sign In for Pricing
View Details MBS9338472-04 10x 96 Well
Human NGFI-A-binding protein 1, NAB1 ELISA Kit
Sign In for Pricing
View Details 
LC404949 20 µg
MMS22L (C6ORF167) (MMS22L) (NM_198468) Human Over-expression Lysate
Sign In for Pricing
View Details