Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap17a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6445407 1.0 µg DNA

Akap17a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
IGHV3OR16-16 Protein Vector (Human) (pPB-C-His)
PV086237 500 ng

IGHV3OR16-16 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CCL3 Antibody
E30AC839 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
Recombinant Human ARL5B Protein
E30P12044 20 µg

Recombinant Human ARL5B Protein

Sign In for Pricing
View Details
Tac1 (NM_009311) Mouse Tagged ORF Clone
MR226087 10 µg

Tac1 (NM_009311) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CPNE1 Peptide
DF12912-BP 1 mg

CPNE1 Peptide

Sign In for Pricing
View Details