Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ST6GAL1 Protein, His Tag
E40KMPH3273 20 µg

Human ST6GAL1 Protein, His Tag

Sign In for Pricing
View Details
OR8D2 Polyclonal Antibody
BT-AP12534-01 20 µL

OR8D2 Polyclonal Antibody

Sign In for Pricing
View Details
OR8D2 Polyclonal Antibody
BT-AP12534-02 50 µL

OR8D2 Polyclonal Antibody

Sign In for Pricing
View Details
OR8D2 Polyclonal Antibody
BT-AP12534-03 100 µL

OR8D2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CCR7 Antibody
CQA0110-01 30 µL

Anti-CCR7 Antibody

Sign In for Pricing
View Details
Anti-CCR7 Antibody
CQA0110-02 50 μL

Anti-CCR7 Antibody

Sign In for Pricing
View Details