Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HLA G Antibody (MEM-G/4) [Janelia Fluor 549]
NB500-533JF549 0.1 mL

Mouse Monoclonal HLA G Antibody (MEM-G/4) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Stenotrophomonas maltophilia NADH-quinone oxidoreductase subunit K (nuoK), partial
MBS7066561 Inquire

Recombinant Stenotrophomonas maltophilia NADH-quinone oxidoreductase subunit K (nuoK), partial

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)
MBS1104613-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)
MBS1104613-02 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)
MBS1104613-03 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)
MBS1104613-04 0.1 mg (Yeast)

Recombinant Prochlorococcus marinus Cell division topological specificity factor (minE)

Sign In for Pricing
View Details