Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDPGP1 Human shRNA Lentiviral Particle (Locus ID 390637)
TL315253V 500 µL Each

GDPGP1 Human shRNA Lentiviral Particle (Locus ID 390637)

Sign In for Pricing
View Details
Lentiviral mouse B3galt1 shRNA (UAS) - Lentiviral mouse B3galt1 shRNA (UAS, RFP) plasmid
GTR15253333 1 Vial

Lentiviral mouse B3galt1 shRNA (UAS) - Lentiviral mouse B3galt1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TFF1 antibody - middle region
MBS3207925-01 0.1 mL

TFF1 antibody - middle region

Sign In for Pricing
View Details
TFF1 antibody - middle region
MBS3207925-02 5x 0.1 mL

TFF1 antibody - middle region

Sign In for Pricing
View Details
FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag, DYKDDDDK tag, ECS Epitope Tag, ECS tag, Enterokinase Cleavage Site Epitope Tag, Enterokinase Cleavage Site tag, FLAG) (MaxLight 650) discontinued
302450-ML650 100 µL

FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag, DYKDDDDK tag, ECS Epitope Tag, ECS tag, Enterokinase Cleavage Site Epitope Tag, Enterokinase Cleavage Site tag, FLAG) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TTBK1, NT (TTBK1, BDTK, KIAA1855, Tau-tubulin kinase 1, Brain-derived tau kinase) (Azide free) (HRP) discontinued
043405-HRP 200 µL

TTBK1, NT (TTBK1, BDTK, KIAA1855, Tau-tubulin kinase 1, Brain-derived tau kinase) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details