Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNY4P10 AAV Vector (Human) (CMV)
40629101 1 µg

RNY4P10 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
2-Hydroxy-3-methylanthraquine
AB2534 5 mg

2-Hydroxy-3-methylanthraquine

Sign In for Pricing
View Details
ARPC2 sgRNA CRISPR Lentivector set (Human)
K0126101 3x 1.0 µg

ARPC2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human SBSN knockdown cell line
ABC-KD13370 1 Vial

Human SBSN knockdown cell line

Sign In for Pricing
View Details
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein
MBS9146695-01 0.01 mg

Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein

Sign In for Pricing
View Details
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein
MBS9146695-02 0.02 mg

Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein

Sign In for Pricing
View Details