Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGC1 alpha/beta Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61390R-BF594-01 20 µL

PGC1 alpha/beta Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PGC1 alpha/beta Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61390R-BF594-02 100 µL

PGC1 alpha/beta Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-human IL-8 (CXCL8) mAb (MT8H6), unconjugated
3560-3-250 250 µg

Anti-human IL-8 (CXCL8) mAb (MT8H6), unconjugated

Sign In for Pricing
View Details
2- (2,3-Dichlorophenoxy) acetohydrazide
413263-01 100 mg

2- (2,3-Dichlorophenoxy) acetohydrazide

Sign In for Pricing
View Details
2- (2,3-Dichlorophenoxy) acetohydrazide
413263-02 250 mg

2- (2,3-Dichlorophenoxy) acetohydrazide

Sign In for Pricing
View Details
Mouse Monoclonal CTL1/SLC44A1 Antibody (4E12)
H00023446-M04 0.1 mg

Mouse Monoclonal CTL1/SLC44A1 Antibody (4E12)

Sign In for Pricing
View Details