Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LINGO-1 Antibody (332237) [Allophycocyanin/Cy7]
FAB30861APCCY7 0.1 mL

Mouse Monoclonal LINGO-1 Antibody (332237) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Human SDCCAG3 knockdown cell line
ABC-KD13466 1 Vial

Human SDCCAG3 knockdown cell line

Sign In for Pricing
View Details
SYF2-set siRNA/shRNA/RNAi Lentivector (Human)
45953091 4x 500 ng

SYF2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
DKC1, Control Peptide (H/ACA Ribonucleoprotein Complex Subunit 4, CBF5 Homolog, Dyskerin, Nopp140-associated Protein of 57kD, Nucleolar Protein NAP57, Nucleolar Protein Family A Member 4, snoRNP Protein DKC1, NOLA4)
147845 100 µg

DKC1, Control Peptide (H/ACA Ribonucleoprotein Complex Subunit 4, CBF5 Homolog, Dyskerin, Nopp140-associated Protein of 57kD, Nucleolar Protein NAP57, Nucleolar Protein Family A Member 4, snoRNP Protein DKC1, NOLA4)

Sign In for Pricing
View Details
SCARA3 (Biotin)
575640-01 50 µg

SCARA3 (Biotin)

Sign In for Pricing
View Details
SCARA3 (Biotin)
575640-02 100 µg

SCARA3 (Biotin)

Sign In for Pricing
View Details