Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sugp2 AAV siRNA Pooled Vector
45831166 1.0 µg

Sugp2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human RPL39L shRNA Plasmid
abx964530-01 150 µg

Human RPL39L shRNA Plasmid

Sign In for Pricing
View Details
Human RPL39L shRNA Plasmid
abx964530-02 300 µg

Human RPL39L shRNA Plasmid

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At4g22390 Polyclonal Antibody
MBS9008016 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At4g22390 Polyclonal Antibody

Sign In for Pricing
View Details
STRAD (G-8) Alexa Fluor® 680
sc-515635 AF680 200 µg/mL

STRAD (G-8) Alexa Fluor® 680

Sign In for Pricing
View Details
TSPAN9 3'UTR GFP Stable Cell Line
TU077318 1.0 mL

TSPAN9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details