Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Human Sirtuin 2 ELISA Kit
GR111451 96 Well

Nori® Human Sirtuin 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal GAPDH Antibody (1A10) [Alexa Fluor 350]
NBP1-47339AF350 0.1 mL

Mouse Monoclonal GAPDH Antibody (1A10) [Alexa Fluor 350]

Sign In for Pricing
View Details
CAPZA2 Polyclonal Antibody
MBS9237858-01 0.1 mL

CAPZA2 Polyclonal Antibody

Sign In for Pricing
View Details
CAPZA2 Polyclonal Antibody
MBS9237858-02 5x 0.1 mL

CAPZA2 Polyclonal Antibody

Sign In for Pricing
View Details
MS4A7 sgRNA CRISPR Lentivector (Human) (Target 3)
K1347004 1.0 µg DNA

MS4A7 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse E2f4 shRNA (UAS) - Lentiviral mouse E2f4 shRNA (UAS) (25)
GTR15198689 1 Vial

Lentiviral mouse E2f4 shRNA (UAS) - Lentiviral mouse E2f4 shRNA (UAS) (25)

Sign In for Pricing
View Details