Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF579 Antibody
NBP1-68922 100 µL

Rabbit Polyclonal ZNF579 Antibody

Sign In for Pricing
View Details
PD-L1 Knockout Stable NBK Cell Line
T6156 1x106 cells / 1.0 mL

PD-L1 Knockout Stable NBK Cell Line

Sign In for Pricing
View Details
RECORD indicators +254°C, VE=50
1216227 50 PCS/PCK

RECORD indicators +254°C, VE=50

Sign In for Pricing
View Details
FADS3, CT (FADS3, CYB5RP, Fatty acid desaturase 3, Cytochrome b5-related protein) (MaxLight 490) discontinued
035339-ML490 100 µL

FADS3, CT (FADS3, CYB5RP, Fatty acid desaturase 3, Cytochrome b5-related protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Homeodomain-interacting protein kinase 2 (HIPK2) Antibody
abx348923-01 20 µg

Homeodomain-interacting protein kinase 2 (HIPK2) Antibody

Sign In for Pricing
View Details
Homeodomain-interacting protein kinase 2 (HIPK2) Antibody
abx348923-02 50 µg

Homeodomain-interacting protein kinase 2 (HIPK2) Antibody

Sign In for Pricing
View Details