Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coliform Broth w/ SLS
M1826-500G 500 g

Coliform Broth w/ SLS

Sign In for Pricing
View Details
OR7G3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1541504 1.0 µg DNA

OR7G3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CD244 Rabbit Polyclonal Antibody
APRab08306-01 20 µL

CD244 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD244 Rabbit Polyclonal Antibody
APRab08306-02 50 µL

CD244 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD244 Rabbit Polyclonal Antibody
APRab08306-03 100 µL

CD244 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD244 Rabbit Polyclonal Antibody
APRab08306-04 200 µL

CD244 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details